PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_014346-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family CO-like
Protein Properties Length: 465aa    MW: 50962 Da    PI: 5.4351
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_014346-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box16.81.4e-05342437
       zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......H 37
                   ++C+ ++  ++  +C+++ + lC +C +  H+       H
  NNU_014346-RA  3 PVCDFCGVARAVVYCRSDITRLCLNCDSFVHSAnaisqrH 42
                   79******99******************999545555555 PP

2zf-B_box18.93.3e-064685439
       zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg.....Htv 39
                    +C++++++++ + C +++++lC++C +++  g     H++
  NNU_014346-RA 46 LICNKCNSQPAVIGCLEDKMYLCQSCDSNGC-GctgpgHRR 85
                   68**************************994.333466665 PP

3CCT61.82.2e-21403446144
            CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                    R++a++RY+eK+ktR F K+irY+sRKa+A++R+RvKGrFvk+ 
  NNU_014346-RA 403 RDKAKMRYNEKKKTRIFGKQIRYASRKARADTRKRVKGRFVKAG 446
                    899**************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003366.5E-9147IPR000315B-box-type zinc finger
PROSITE profilePS501198.745147IPR000315B-box-type zinc finger
CDDcd000213.52E-5347No hitNo description
PfamPF062031.5E-16403445IPR010402CCT domain
PROSITE profilePS5101714.574403445IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 465 aa     Download sequence    Send to blast
MDPVCDFCGV ARAVVYCRSD ITRLCLNCDS FVHSANAISQ RHCRSLICNK CNSQPAVIGC  60
LEDKMYLCQS CDSNGCGCTG PGHRRQAVTF YSGSPTALEL SRIWPSNSNA SSPPREVNAS  120
LEPPGLMSMN ENCISNSWEP RDNGSSSAGL TTTNRLNELE PCTTFDPWAC PSSVIQHSVS  180
SMPYCEDKPP FFPEELKLSK AVSYDVQQGC SPLKDLEICH GGDLCEGLNM DGVELNFENS  240
DEIFGCSESQ PSHSFEDIGM DCLFMDKNFS VADSSCPSEN VLEAPYISCM ADNHLCSHLH  300
QASSSSGQPD YIALQSSYGA GSATAVQGIN SATDRVFLNP NHNKNINLSF PPQQVNSSLS  360
LSFSNLTGES SVSDYQDCGV SPMFLTGESP WDSNLDTSCP QARDKAKMRY NEKKKTRIFG  420
KQIRYASRKA RADTRKRVKG RFVKAGEAYD YDPLILLLPR AFHRA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010267889.10.0PREDICTED: putative zinc finger protein CONSTANS-LIKE 11
TrEMBLA0A061E4E21e-154A0A061E4E2_THECC; CONSTANS-like zinc finger protein, putative
STRINGGLYMA12G32221.11e-149(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G21880.19e-88B-box type zinc finger protein with CCT domain